Category: GATE Biotechnology Previous Year Papers with Solutions

30. In DNA sequencing reactions usmg the chain termination method, the ratio of ddNTPs to dNTPs should be (A) 0          (B) 1 Correct Answer: (B) (A) […]

29. How many different protein sequences of 100 residues can be generated using 20 standard amino acids? (A) 10020 (B) 100 × 20 (C) 20100 (D) 100! × 20! A […]

28. How many 3-tuples are possible for the following amino acid sequence? MADCMWDISAESE (A) 4 (B) 5 (C) 11 (D) 12 How Many 3-Tuples in Amino Acid Sequence MADCMWDISAE? The […]

27. Which one of the following relations holds true for the specific growth rate (μ) of a microorganism in the death phase? (A) μ = 0 (B) μ < 0 […]

26. Identify the file format given below: >P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTRLQQGDWL (A) GDE (B) FASTA (C) NBRF (D) GCG Identify File Format: >P1; JMFD Protein X […]

25. Which one of the following is INCORRECT about a typical apoptotic cell? (A) Phosphatidylserine is presented on the outer cell surface (B) Cytochrome c is released from mitochondria (C) […]

24. Production of monoclonal antibodies by hybridoma technology requires (A) splenocytes (B) osteocytes (C) hepatocytes (D) thymocytes Production of monoclonal antibodies by hybridoma technology requires splenocytes. This multiple-choice question tests knowledge […]

23. Which one of the following features is NOT required in a prokaryotic expression vector? (A) oriC (B) Selection marker (C) CMV promoter (D) Ribosome binding site Answer: (C) CMV […]

22. The determinant of the matrix is __________. 3 0 0 2 5 0 6 −8 −4   Introduction Finding the determinant of the given matrix is an important topic […]

21. Which one of the following is NOT a product of denitrification in Pseudomonas? (A) N2 (B) N2O (C) NO2− (D) NH4+ Answer: (D) NH4+ Denitrification in Pseudomonas species is a key […]