26. Identify the file format given below:
>P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTRLQQGDWL
(A) GDE
(B) FASTA
(C) NBRF
(D) GCG
Identify File Format: >P1; JMFD Protein X – Homo sapiens Sequence
The given sequence “>P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTRLQQGDWL” represents the FASTA file format, commonly used in bioinformatics for nucleotide or protein sequences.
Option Analysis
FASTA format starts with a “>” symbol followed by a header line containing identifiers like accession numbers (e.g., P1; JMFD) and descriptions (e.g., Protein X – Homo sapiens), then the sequence on subsequent lines using single-letter amino acid codes.
-
(A) GDE: General Data Exchange format uses numbered lines starting with sequence length and one-letter codes without “>” headers; lacks the descriptive header seen here.
-
(B) FASTA: Matches exactly with “>” initiating the definition line, semicolon-separated identifiers, species info, and plain sequence text. Correct answer.
-
(C) NBRF: Also called PIR format, begins with two-letter type code (e.g., “DL”), entry name on next line, and ends with “*” terminator; no “>” symbol.
-
(D) GCG: GCG (Wisconsin Package) format includes sequence length, checksums, and starts differently (e.g., “!!NA_SEQUENCE 1.0”); lacks “>” and uses double exclamation marks.
The identify file format FASTA >P1; JMFD protein sequence example “>P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTRLQQGDWL” is a classic bioinformatics puzzle for students mastering molecular biology tools. This identify file format challenge tests knowledge of sequence standards essential for genomics, proteomics, and biotech research in tools like BLAST or Clustal.
FASTA Format Breakdown
FASTA dominates bioinformatics due to its simplicity: “>” header with accession (P1; JMFD), description (Protein X – Homo sapiens), followed by amino acids (MKALTARQQEVFDLIRDHISRTRLQQGDWL). No line length limits post-header; supports multi-sequences. Widely used in NCBI databases and software.
Comparing Sequence Formats
| Format | Header Style | Key Features | Matches Example? |
|---|---|---|---|
| GDE | Numbered length | No “>”, plain codes | No |
| FASTA | “>” symbol | ID; description + sequence | Yes |
| NBRF | Two-letter code | “*” terminator | No |
| GCG | !!AA_SEQUENCE | Checksum, length | No |
Why FASTA for Bioinformatics?
Ideal for graduate students in biotechnology or molecular biology analyzing microbial genomes or protein structures. Parse easily in Python (Biopython) or R for phylogenetics and fermentation studies.
This identify file format FASTA >P1; JMFD protein sequence skill boosts exam performance and lab efficiency in Jaipur biotech hubs.
