146. Parents who appear normal have a child with sickle cell anemia, which is an autosomal recessive trait. The woman becomes pregnant again and is told that she is carrying […]
Blog
DBT BET JRF 2022 Previous Year Questions and Video solution
Why Mammalian Expression Systems Are Preferred for Monoclonal Antibody Production
181. For monoclonal antibody production, mammalian expression systems are preferred over bacterial expression systems, primarily because: A. mammalian cultures have better productivity B. mammalian cultures produce extra-cellular product simplifying the […]
DBT BET JRF 2018 Previous Year Questions and Video solution
Understanding E-values in BLAST Searches Across Different Databases
145. Of the two databases A and B, the database A is larger in size than database B. In a BLAST search, a sequence has a highly significant match with […]
DBT BET JRF 2018 Previous Year Questions and Video solution
Tools for Establishing Evolutionary Links Between Proteins with Low Sequence Similarity
144. Which one of the following tools can reliably establish an evolutionary link between two proteins and align them even if they share very low degree of sequence similarity? 1. […]
DBT BET JRF 2022 Previous Year Questions and Video solution
DNA Fingerprinting: Commonly Used Markers STRs VNTRs RFLP
180. Which one of the following markers is NOT routinely used for DNA fingerprinting? A. Amplification short tandem repeats B. Analysis of copy number variations C. Restriction fragment length polymorphism […]
DBT BET JRF 2018 Previous Year Questions and Video solution
Understanding Amino Acid Substitution Matrices Based on Genetic Code for Sequence Alignment
143. A sample genetic code is given below: If an amino acid substitution matrix based on genetic code is derived for sequence alignment and analysis from evolutionary studies, which one […]
DBT BET JRF 2022 Previous Year Questions and Video solution
Active Ingredient in Ground Shark Cartilage Ointment for Wound Healing
179. Ground shark cartilage ointment is popular for its role in fast wound recovery. The active ingredient primarily responsible for this function is: A. N-acetylglucosamine B. Hydroxyproline C. Dihydroxyproline D. […]
DBT BET JRF 2018 Previous Year Questions and Video solution
Identifying the Highest-Scoring Alignment in Sequences: A Guide to Alignment Algorithms
142. Two sequences of comparable length have several regions that align locally, but are separated by other regions that align poorly. Which algorithm can be used to find the highest-scoring […]
DBT BET JRF 2022 Previous Year Questions and Video solution
Molecular Formula and Molecular Weight of Maltose
178. Given the molecular structure of glucose, the molecular formula and molecular weight of maltose will be: A. 𝐶12𝐻24𝑂12, 360 Daltons B. 𝐶12𝐻24𝑂12, 460 Daltons C. 𝐶12𝐻22𝑂11, 342 Daltons D. […]
DBT BET JRF 2018 Previous Year Questions and Video solution
Understanding the GenBank Sequence Entry Format
Question Which one of the following is a depiction of the GenBank sequence entry format? >YCZ2_YEAST protein in HMR 3′ region MKAVVIEDGKAVVKEGVPIPELEEGFVGNPTDWAHIDYKVGPQSILGCDAAGQG* BASE COUNT 215 A 224 G 263 G […]
