179. Ground shark cartilage ointment is popular for its role in fast wound recovery. The active ingredient primarily responsible for this function is: A. N-acetylglucosamine B. Hydroxyproline C. Dihydroxyproline D. […]
Blog
Identifying the Highest-Scoring Alignment in Sequences: A Guide to Alignment Algorithms
142. Two sequences of comparable length have several regions that align locally, but are separated by other regions that align poorly. Which algorithm can be used to find the highest-scoring […]
Molecular Formula and Molecular Weight of Maltose
178. Given the molecular structure of glucose, the molecular formula and molecular weight of maltose will be: A. 𝐶12𝐻24𝑂12, 360 Daltons B. 𝐶12𝐻24𝑂12, 460 Daltons C. 𝐶12𝐻22𝑂11, 342 Daltons D. […]
Understanding the GenBank Sequence Entry Format
Question Which one of the following is a depiction of the GenBank sequence entry format? >YCZ2_YEAST protein in HMR 3′ region MKAVVIEDGKAVVKEGVPIPELEEGFVGNPTDWAHIDYKVGPQSILGCDAAGQG* BASE COUNT 215 A 224 G 263 G […]
Identifying AMP Binding Proteins Using PROSITE Motif Pattern
138. The PROSITE pattern representing the conserved sequence motif for a new family of AMP binding protein is [LIVMFY]-X(2)-[STG]-[STAG]-G-[ST]. You are given a sequence of a 15-amino acid stretch starting […]
Impact of Dilution on pH of Tris-HCl Solution
177. A 1 M Tris-HCI (pH 8.0) solution was diluted 10 fold. What will be the pH of the resulting solution? A. 8.0 B. 7.0 C. 0.08 D. 0.8 Introduction […]
Measuring Similarity Between Predicted and Experimental Protein Structures: A Guide
137. Which one of the following can be used to measure the extent of similarity between the predicted structure of a protein and its experimentally determined structure? 1. Root mean […]
Overexpression of Lectin Genes in Plants and Its Effect on Resistance
176. In plants, the overexpression of lectin genes confers resistance to: A. Virus B. Insects C. Fungus D. Bacteria Introduction In the world of plant biotechnology, lectin genes have […]
Protein Structure Prediction: Understanding Energy Minimization in Conformational Space
136. Which one of the following protein structure prediction methods is based on the principle of locating lowest energy minimum in the conformation space of a protein? 1. Ab initio […]
Understanding Molecular Weight Differences Between Molecules
175. What, if any, is the difference between the molecular weights of molecule A (left) vs molecule B (right) ? A. Molecular weight of the two are identical B. Molecular […]


