Tag: GATE Biotechnology Previous Year Papers with Solutions

31. Which of the following gaphs represents uncompetitive inhibition? Introduction Questions based on enzyme inhibition are very common in biochemistry and competitive exams like NEET, CSIR-NET, GATE, and university exams. […]

30. In DNA sequencing reactions usmg the chain termination method, the ratio of ddNTPs to dNTPs should be (A) 0          (B) 1 Correct Answer: (B) (A) […]

29. How many different protein sequences of 100 residues can be generated using 20 standard amino acids? (A) 10020 (B) 100 × 20 (C) 20100 (D) 100! × 20! A […]

28. How many 3-tuples are possible for the following amino acid sequence? MADCMWDISAESE (A) 4 (B) 5 (C) 11 (D) 12 How Many 3-Tuples in Amino Acid Sequence MADCMWDISAE? The […]

27. Which one of the following relations holds true for the specific growth rate (μ) of a microorganism in the death phase? (A) μ = 0 (B) μ < 0 […]

26. Identify the file format given below: >P1; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTRLQQGDWL (A) GDE (B) FASTA (C) NBRF (D) GCG Identify File Format: >P1; JMFD Protein X […]

25. Which one of the following is INCORRECT about a typical apoptotic cell? (A) Phosphatidylserine is presented on the outer cell surface (B) Cytochrome c is released from mitochondria (C) […]

24. Production of monoclonal antibodies by hybridoma technology requires (A) splenocytes (B) osteocytes (C) hepatocytes (D) thymocytes Production of monoclonal antibodies by hybridoma technology requires splenocytes. This multiple-choice question tests knowledge […]

23. Which one of the following features is NOT required in a prokaryotic expression vector? (A) oriC (B) Selection marker (C) CMV promoter (D) Ribosome binding site Answer: (C) CMV […]

22. The determinant of the matrix is __________. 3 0 0 2 5 0 6 −8 −4   Introduction Finding the determinant of the given matrix is an important topic […]