143. A sample genetic code is given below: If an amino acid substitution matrix based on genetic code is derived for sequence alignment and analysis from evolutionary studies, which one […]
Blog
DBT BET JRF 2022 Previous Year Questions and Video solution
Active Ingredient in Ground Shark Cartilage Ointment for Wound Healing
179. Ground shark cartilage ointment is popular for its role in fast wound recovery. The active ingredient primarily responsible for this function is: A. N-acetylglucosamine B. Hydroxyproline C. Dihydroxyproline D. […]
DBT BET JRF 2018 Previous Year Questions and Video solution
Identifying the Highest-Scoring Alignment in Sequences: A Guide to Alignment Algorithms
142. Two sequences of comparable length have several regions that align locally, but are separated by other regions that align poorly. Which algorithm can be used to find the highest-scoring […]
DBT BET JRF 2022 Previous Year Questions and Video solution
Molecular Formula and Molecular Weight of Maltose
178. Given the molecular structure of glucose, the molecular formula and molecular weight of maltose will be: A. 𝐶12𝐻24𝑂12, 360 Daltons B. 𝐶12𝐻24𝑂12, 460 Daltons C. 𝐶12𝐻22𝑂11, 342 Daltons D. […]
DBT BET JRF 2018 Previous Year Questions and Video solution
Understanding the GenBank Sequence Entry Format
Question Which one of the following is a depiction of the GenBank sequence entry format? >YCZ2_YEAST protein in HMR 3′ region MKAVVIEDGKAVVKEGVPIPELEEGFVGNPTDWAHIDYKVGPQSILGCDAAGQG* BASE COUNT 215 A 224 G 263 G […]
DBT BET JRF 2018 Previous Year Questions and Video solution
Identifying AMP Binding Proteins Using PROSITE Motif Pattern
138. The PROSITE pattern representing the conserved sequence motif for a new family of AMP binding protein is [LIVMFY]-X(2)-[STG]-[STAG]-G-[ST]. You are given a sequence of a 15-amino acid stretch starting […]
DBT BET JRF 2022 Previous Year Questions and Video solution
Impact of Dilution on pH of Tris-HCl Solution
177. A 1 M Tris-HCI (pH 8.0) solution was diluted 10 fold. What will be the pH of the resulting solution? A. 8.0 B. 7.0 C. 0.08 D. 0.8 Introduction […]
DBT BET JRF 2018 Previous Year Questions and Video solution
Measuring Similarity Between Predicted and Experimental Protein Structures: A Guide
137. Which one of the following can be used to measure the extent of similarity between the predicted structure of a protein and its experimentally determined structure? 1. Root mean […]
DBT BET JRF 2022 Previous Year Questions and Video solution
Overexpression of Lectin Genes in Plants and Its Effect on Resistance
176. In plants, the overexpression of lectin genes confers resistance to: A. Virus B. Insects C. Fungus D. Bacteria Introduction In the world of plant biotechnology, lectin genes have […]
DBT BET JRF 2018 Previous Year Questions and Video solution
Protein Structure Prediction: Understanding Energy Minimization in Conformational Space
136. Which one of the following protein structure prediction methods is based on the principle of locating lowest energy minimum in the conformation space of a protein? 1. Ab initio […]
