Tag: dbt jrf 2018

143. A sample genetic code is given below: If an amino acid substitution matrix based on genetic code is derived for sequence alignment and analysis from evolutionary studies, which one […]

142. Two sequences of comparable length have several regions that align locally, but are separated by other regions that align poorly. Which algorithm can be used to find the highest-scoring […]

Question Which one of the following is a depiction of the GenBank sequence entry format? >YCZ2_YEAST protein in HMR 3′ region MKAVVIEDGKAVVKEGVPIPELEEGFVGNPTDWAHIDYKVGPQSILGCDAAGQG* BASE COUNT 215 A 224 G 263 G […]

138. The PROSITE pattern representing the conserved sequence motif for a new family of AMP binding protein is [LIVMFY]-X(2)-[STG]-[STAG]-G-[ST]. You are given a sequence of a 15-amino acid stretch starting […]

137. Which one of the following can be used to measure the extent of similarity between the predicted structure of a protein and its experimentally determined structure? 1. Root mean […]

136. Which one of the following protein structure prediction methods is based on the principle of locating lowest energy minimum in the conformation space of a protein? 1. Ab initio […]

135. X, Y and Z correspond to three different conformers of an 18-residue peptide, where X: α helix, Y: β strand and Z: 310 helix. Which of the following correspond […]

133. Which of the following corresponds to the amino acid pair having maximum and minimum number of allowed conformations in the Ramachandran plot? 1. Max: Gly, Min: Pro 2. Max: […]

132. Cis-peptide unit corresponds to the O-C-N-H dihedral angle (degrees) of: 1. 0 2. -60 3. 120 4. 180 Question Cis-peptide unit corresponds to the O-C-N-H dihedral angle (degrees) of: […]